ALDH4A1 Polyclonal AntibodyALDH4A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALDH4A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13569-200ul 200ul
£332.50
A13569-100ul 100ul
£192.50
A13569-50ul 50ul
£113.75
A13569-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13569
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALDH4A1; ALDH4; P5CD; P5CDh; aldehyde dehydrogenase 4 family member A1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-563 of human ALDH4A1 (NP_003739.2).
Reactivity Human, Mouse
Gene ID 8659
Calculated MW 55kDa/56kDa/61kDa
Observed MW 61kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents