ALDH1B1 Polyclonal AntibodyALDH1B1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALDH1B1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3725-200ul 200ul
£332.50
A3725-100ul 100ul
£192.50
A3725-50ul 50ul
£113.75
A3725-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3725
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALDH1B1; ALDH5; ALDHX; aldehyde dehydrogenase X, mitochondrial
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 278-517 of human ALDH1B1 (NP_000683.3).
Reactivity Human, Mouse, Rat
Gene ID 219
Calculated MW 57kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents