ALAS1 Polyclonal AntibodyALAS1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALAS1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13462-200ul 200ul
£332.50
A13462-100ul 100ul
£192.50
A13462-50ul 50ul
£113.75
A13462-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13462
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALAS1; ALAS; ALAS-H; ALAS3; ALASH; MIG4; 5'-aminolevulinate synthase 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ALAS1 (NP_954635.1).
Reactivity Human, Mouse, Rat
Gene ID 211
Calculated MW 12kDa/70kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents