AKR1E2 Polyclonal AntibodyAKR1E2 Polyclonal Antibody
Move your mouse over image or click to enlarge

AKR1E2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13730-200ul 200ul
£332.50
A13730-100ul 100ul
£192.50
A13730-50ul 50ul
£113.75
A13730-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13730
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AKR1E2; AKR1CL2; AKRDC1; LoopADR; hTSP; htAKR; TAKR; 1,5-anhydro-D-fructose reductase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AKR1E2 (NP_001035267.1).
Reactivity Human
Gene ID 83592
Calculated MW 25kDa/28kDa/30kDa/34kDa/36kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents