AKR1C3 Polyclonal AntibodyAKR1C3 Polyclonal Antibody
Move your mouse over image or click to enlarge

AKR1C3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13568-200ul 200ul
£332.50
A13568-100ul 100ul
£192.50
A13568-50ul 50ul
£113.75
A13568-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13568
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AKR1C3; DD3; DDX; HA1753; HAKRB; HAKRe; HSD17B5; PGFS; hluPGFS; aldo-keto reductase family 1 member C3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C3 (NP_003730.4).
Reactivity Human, Mouse, Rat
Gene ID 8644
Calculated MW 23kDa/36kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents