AK3 Polyclonal AntibodyAK3 Polyclonal Antibody
Move your mouse over image or click to enlarge

AK3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4694-200ul 200ul
£332.50
A4694-100ul 100ul
£192.50
A4694-50ul 50ul
£113.75
A4694-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4694
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AK3; AK3L1; AK6; AKL3L; AKL3L1; FIX; adenylate kinase 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human AK3 (NP_057366.2).
Reactivity Human, Mouse, Rat
Gene ID 50808
Calculated MW 18kDa/21kDa/25kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents