AHCY Polyclonal AntibodyAHCY Polyclonal Antibody
Move your mouse over image or click to enlarge

AHCY Polyclonal Antibody

Cat# Size Price Qty Buy
A14182-200ul 200ul
£332.50
A14182-100ul 100ul
£192.50
A14182-50ul 50ul
£113.75
A14182-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14182
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AHCY; SAHH; adoHcyase; adenosylhomocysteinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 253-432 of human AHCY (NP_000678.1).
Reactivity Human, Rat
Gene ID 191
Calculated MW 44kDa/47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents