AGXT Polyclonal AntibodyAGXT Polyclonal Antibody
Move your mouse over image or click to enlarge

AGXT Polyclonal Antibody

Cat# Size Price Qty Buy
A13943-200ul 200ul
£332.50
A13943-100ul 100ul
£192.50
A13943-50ul 50ul
£113.75
A13943-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13943
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AGXT; AGT; AGT1; AGXT1; PH1; SPAT; SPT; TLH6; serine--pyruvate aminotransferase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 183-392 of human AGXT (NP_000021.1).
Reactivity Mouse, Rat
Gene ID 189
Calculated MW 43kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents