AGTR1 Polyclonal AntibodyAGTR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

AGTR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14201-200ul 200ul
£332.50
A14201-100ul 100ul
£192.50
A14201-50ul 50ul
£113.75
A14201-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14201
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AGTR1; AG2S; AGTR1B; AT1; AT1AR; AT1B; AT1BR; AT1R; AT2R1; HAT1R; type-1 angiotensin II receptor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human AGTR1 (NP_000676.1).
Reactivity Human, Mouse, Rat
Gene ID 185
Calculated MW 41kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents