AFAP1L2 Polyclonal AntibodyAFAP1L2 Polyclonal Antibody
Move your mouse over image or click to enlarge

AFAP1L2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15916-20ul 20ul
£77.00
A15916-50ul 50ul
£113.75
A15916-100ul 100ul
£192.50
A15916-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15916
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AFAP1L2; CTB-1144G6.4; KIAA1914; XB130; actin filament-associated protein 1-like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human AFAP1L2 (NP_001001936.1).
Reactivity Human
Gene ID 84632
Calculated MW 38kDa/90kDa/91kDa/93kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEAVSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents