ADH1B Polyclonal AntibodyADH1B Polyclonal Antibody
Move your mouse over image or click to enlarge

ADH1B Polyclonal Antibody

Cat# Size Price Qty Buy
A1431-200ul 200ul
£332.50
A1431-100ul 100ul
£192.50
A1431-50ul 50ul
£113.75
A1431-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1431
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ADH1B; ADH2; HEL-S-117; alcohol dehydrogenase 1B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-375 of human ADH1B (NP_000659.2).
Reactivity Rat
Gene ID 125
Calculated MW 35kDa/39kDa
Observed MW 40kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents