ADCYAP1R1 Polyclonal AntibodyADCYAP1R1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ADCYAP1R1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13859-200ul 200ul
£332.50
A13859-100ul 100ul
£192.50
A13859-50ul 50ul
£113.75
A13859-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13859
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ADCYAP1R1; PAC1; PAC1R; PACAPR; PACAPRI; ADCYAP receptor type I
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-155 of human ADCYAP1R1 (NP_001186564.1).
Reactivity Human, Mouse, Rat
Gene ID 117
Calculated MW 46kDa/51kDa/53kDa/54kDa/56kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents