ADAM23 Polyclonal AntibodyADAM23 Polyclonal Antibody
Move your mouse over image or click to enlarge

ADAM23 Polyclonal Antibody

Cat# Size Price Qty Buy
A14263-200ul 200ul
£332.50
A14263-100ul 100ul
£192.50
A14263-50ul 50ul
£113.75
A14263-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14263
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ADAM23; MDC-3; MDC3; ADAM metallopeptidase domain 23
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human ADAM23 (NP_003803.1).
Reactivity Human, Mouse, Rat
Gene ID 8745
Calculated MW 91kDa/92kDa
Observed MW 92kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents