ACTR10 Polyclonal AntibodyACTR10 Polyclonal Antibody
Move your mouse over image or click to enlarge

ACTR10 Polyclonal Antibody

Cat# Size Price Qty Buy
A15867-20ul 20ul
£77.00
A15867-50ul 50ul
£113.75
A15867-100ul 100ul
£192.50
A15867-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15867
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ACTR10; ACTR11; Arp10; Arp11; HARP11; actin-related protein 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 218-417 of human ACTR10 (NP_060947.1).
Reactivity Human, Mouse, Rat
Gene ID 55860
Calculated MW 46kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents