ACSS3 Polyclonal AntibodyACSS3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ACSS3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13781-200ul 200ul
£332.50
A13781-100ul 100ul
£192.50
A13781-50ul 50ul
£113.75
A13781-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13781
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ACSS3; acyl-CoA synthetase short-chain family member 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-280 of human ACSS3 (NP_078836.1).
Reactivity Mouse, Rat
Gene ID 79611
Calculated MW 40kDa/74kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents