ACSL5 Polyclonal AntibodyACSL5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ACSL5 Polyclonal Antibody

Cat# Size Price Qty Buy
A14130-200ul 200ul
£332.50
A14130-100ul 100ul
£192.50
A14130-50ul 50ul
£113.75
A14130-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14130
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ACSL5; ACS2; ACS5; FACL5; long-chain-fatty-acid--CoA ligase 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-739 of human ACSL5 (NP_057318.2).
Reactivity Human, Mouse, Rat
Gene ID 51703
Calculated MW 73kDa/75kDa/82kDa
Observed MW 76kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents