ACSF3 Polyclonal AntibodyACSF3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ACSF3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13769-200ul 200ul
£332.50
A13769-100ul 100ul
£192.50
A13769-50ul 50ul
£113.75
A13769-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13769
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ACSF3; acyl-CoA synthetase family member 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human ACSF3 (NP_001230208.1).
Reactivity Human, Mouse, Rat
Gene ID 197322
Calculated MW 64kDa
Observed MW 64kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FSPQQVWEKFLSSETPRINVFMAVPTIYTKLMEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEIGMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEEKEGELLVRGPSVFREYWNKPEETKSAFTLD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents