ACMSD Polyclonal AntibodyACMSD Polyclonal Antibody
Move your mouse over image or click to enlarge

ACMSD Polyclonal Antibody

Cat# Size Price Qty Buy
A15953-20ul 20ul
£77.00
A15953-50ul 50ul
£113.75
A15953-100ul 100ul
£192.50
A15953-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15953
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ACMSD; aminocarboxymuconate semialdehyde decarboxylase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human ACMSD (NP_612199.2).
Reactivity Mouse, Rat
Gene ID 130013
Calculated MW 31kDa/38kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents