ABI1 Polyclonal AntibodyABI1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ABI1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16092-20ul 20ul
£77.00
A16092-50ul 50ul
£113.75
A16092-100ul 100ul
£192.50
A16092-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16092
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ABI1; ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1; abl interactor 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770).
Reactivity Mouse
Gene ID 10006
Calculated MW 35-55kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents