ABCG1 Polyclonal AntibodyABCG1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ABCG1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13158-200ul 200ul
£332.50
A13158-100ul 100ul
£192.50
A13158-50ul 50ul
£113.75
A13158-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13158
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ABCG1; ABC8; WHITE1; ATP binding cassette subfamily G member 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ABCG1 (NP_004906.3).
Reactivity Human, Mouse, Rat
Gene ID 9619
Calculated MW 71kDa/73kDa/74kDa/75kDa/86kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents