ABCF2 Polyclonal AntibodyABCF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ABCF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4365-200ul 200ul
£332.50
A4365-100ul 100ul
£192.50
A4365-50ul 50ul
£113.75
A4365-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4365
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ABCF2; ABC28; EST133090; HUSSY-18; HUSSY18; ATP binding cassette subfamily F member 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2).
Reactivity Human, Mouse
Gene ID 10061
Calculated MW 71kDa/72kDa
Observed MW 72kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFML
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents