ABCD2 Polyclonal AntibodyABCD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ABCD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A16033-20ul 20ul
£77.00
A16033-50ul 50ul
£113.75
A16033-100ul 100ul
£192.50
A16033-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16033
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ABCD2; ABC39; ALDL1; ALDR; ALDRP; hALDR; ATP binding cassette subfamily D member 2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-500 of human ABCD2 (NP_005155.1).
Reactivity Human, Mouse, Rat
Gene ID 225
Calculated MW 83kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence TARVYNMFWVFDEVKRGIYKRTAVIQESESHSKNGAKVELPLSDTLAIKGKVIDVDHGIICENVPIITPAGEVVASRLNFK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents