ABCB10 Polyclonal AntibodyABCB10 Polyclonal Antibody
Move your mouse over image or click to enlarge

ABCB10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13787-200ul 200ul
£332.50
A13787-100ul 100ul
£192.50
A13787-50ul 50ul
£113.75
A13787-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13787
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ABCB10; EST20237; M-ABC2; MTABC2; ATP binding cassette subfamily B member 10
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-300 of human ABCB10 (NP_036221.2).
Reactivity Human, Mouse, Rat
Gene ID 23456
Calculated MW 79kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents