AAMP Polyclonal AntibodyAAMP Polyclonal Antibody
Move your mouse over image or click to enlarge

AAMP Polyclonal Antibody

Cat# Size Price Qty Buy
A3283-200ul 200ul
£332.50
A3283-100ul 100ul
£192.50
A3283-50ul 50ul
£113.75
A3283-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3283
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AAMP; angio-associated migratory cell protein
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 85-434 of human AAMP (NP_001078.2).
Reactivity Human, Mouse, Rat
Gene ID 14
Calculated MW 46kDa
Observed MW 47kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR
Sensitivity WB,1:1000 - 1:3000|IF,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents