ZP3 Polyclonal AntibodyZP3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZP3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13156-200ul 200ul
£332.50
A13156-100ul 100ul
£192.50
A13156-50ul 50ul
£113.75
A13156-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13156
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZP3; ZP3A; ZP3B; ZPC; Zp-3; zona pellucida glycoprotein 3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ZP3 (NP_001103824.1).
Reactivity Human, Mouse, Rat
Gene ID 7784
Calculated MW 41kDa/47kDa
Observed MW 47kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRN
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents