ZNRF3 Polyclonal AntibodyZNRF3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNRF3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16026-20ul 20ul
£77.00
A16026-50ul 50ul
£113.75
A16026-100ul 100ul
£192.50
A16026-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16026
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNRF3; BK747E2.3; RNF203; zinc and ring finger 3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZNRF3 (NP_115549.2).
Reactivity Human, Mouse, Rat
Gene ID 84133
Calculated MW 100kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents