ZNRF1 Polyclonal AntibodyZNRF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNRF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15918-20ul 20ul
£77.00
A15918-50ul 50ul
£113.75
A15918-100ul 100ul
£192.50
A15918-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15918
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNRF1; NIN283; zinc and ring finger 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1).
Reactivity Human, Mouse, Rat
Gene ID 84937
Calculated MW 23kDa/29kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents