ZNF766 Polyclonal AntibodyZNF766 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF766 Polyclonal Antibody

Cat# Size Price Qty Buy
A15925-20ul 20ul
£77.00
A15925-50ul 50ul
£113.75
A15925-100ul 100ul
£192.50
A15925-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15925
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF766; zinc finger protein 766
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human ZNF766 (NP_001010851.1).
Reactivity Mouse, Rat
Gene ID 90321
Calculated MW 54kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQLGLTFQLPLPELEIFQGEGKIYECNQVQKFISHSSSVSPLQRIYSGVKTHIFNKHRNDFVDFPLLSQEQKAHIRRKPYECN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents