ZNF641 Polyclonal AntibodyZNF641 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF641 Polyclonal Antibody

Cat# Size Price Qty Buy
A14438-200ul 200ul
£332.50
A14438-100ul 100ul
£192.50
A14438-50ul 50ul
£113.75
A14438-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14438
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF641; zinc finger protein 641
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human ZNF641 (NP_689533.2).
Reactivity Human, Mouse
Gene ID 121274
Calculated MW 43kDa/46kDa/48kDa/49kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCSTEMDSL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents