ZNF581 Polyclonal AntibodyZNF581 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF581 Polyclonal Antibody

Cat# Size Price Qty Buy
A13162-200ul 200ul
£332.50
A13162-100ul 100ul
£192.50
A13162-50ul 50ul
£113.75
A13162-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13162
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF581; HSPC189; zinc finger protein 581
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1).
Reactivity Human, Mouse, Rat
Gene ID 51545
Calculated MW 22kDa
Observed MW 22-24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents