ZNF551 Polyclonal AntibodyZNF551 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF551 Polyclonal Antibody

Cat# Size Price Qty Buy
A13780-200ul 200ul
£332.50
A13780-100ul 100ul
£192.50
A13780-50ul 50ul
£113.75
A13780-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13780
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF551; zinc finger protein 551
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human ZNF551 (NP_612356.2).
Reactivity Human, Mouse
Gene ID 90233
Calculated MW 41kDa/69kDa/77kDa
Observed MW 77kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VALRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAAEHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQHQSVCSEGGL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents