ZNF544 Polyclonal AntibodyZNF544 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF544 Polyclonal Antibody

Cat# Size Price Qty Buy
A14120-200ul 200ul
£332.50
A14120-100ul 100ul
£192.50
A14120-50ul 50ul
£113.75
A14120-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14120
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF544; zinc finger protein 544
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ZNF544 (NP_055295.2).
Reactivity Mouse, Rat
Gene ID 27300
Calculated MW 81kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHIVSLGLFLSKSDVISQLEQEEDLCRAEQEAPRDWKATLEENRLNSEKDRAREELSHHVEVYRSGPEEPPSLVLGKVQDQSNQLREHQENSLRFMVLTSERLFAQREHCELELGGGYSLPSTLSLLPTTLPTSTGFPKPNSQVKELKQNSAFINHEKNGADGKHCESHQCARAFCQSIYLSK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents