ZNF517 Polyclonal AntibodyZNF517 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF517 Polyclonal Antibody

Cat# Size Price Qty Buy
A15979-20ul 20ul
£77.00
A15979-50ul 50ul
£113.75
A15979-100ul 100ul
£192.50
A15979-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15979
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF517; zinc finger protein 517
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-180 of human ZNF517 (NP_998770.2).
Reactivity Human
Gene ID 340385
Calculated MW 54kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EEPGALILQVAEQSVAKASLCTDSRMEAGIMESPLQRKLSRQAGLPGTVWGCLPWGHPVGGHPAPPHPHGGPEDGSDKPTHPRAREHSASPRVLQEDLGRPVGSSAPRYRC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents