ZNF384 Polyclonal AntibodyZNF384 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF384 Polyclonal Antibody

Cat# Size Price Qty Buy
A15964-20ul 20ul
£77.00
A15964-50ul 50ul
£113.75
A15964-100ul 100ul
£192.50
A15964-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15964
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF384; CAGH1; CAGH1A; CIZ; ERDA2; NMP4; NP; TNRC1; zinc finger protein 384
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ZNF384 (NP_001035009.1).
Reactivity Human, Mouse, Rat
Gene ID 171017
Calculated MW 50kDa/56kDa/63kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents