ZNF286A Polyclonal AntibodyZNF286A Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF286A Polyclonal Antibody

Cat# Size Price Qty Buy
A14415-200ul 200ul
£332.50
A14415-100ul 100ul
£192.50
A14415-50ul 50ul
£113.75
A14415-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14415
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF286A; ZNF286; zinc finger protein 286A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human ZNF286A (NP_065703.1).
Reactivity Human
Gene ID 57335
Calculated MW 59kDa/60kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence KDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALECENWLENQQGNQERHLREMFTHMNSLSEETDHKHDVYWKSFNQKSVLITEDRVPKGSYAFHTLEKSLKQKSNLMKKQRTYKEK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents