ZNF264 Polyclonal AntibodyZNF264 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF264 Polyclonal Antibody

Cat# Size Price Qty Buy
A14089-200ul 200ul
£332.50
A14089-100ul 100ul
£192.50
A14089-50ul 50ul
£113.75
A14089-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14089
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF264; zinc finger protein 264
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ZNF264 (NP_003408.1).
Reactivity Human, Mouse, Rat
Gene ID 9422
Calculated MW 70kDa
Observed MW 71kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKAELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAG
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents