ZNF2 Polyclonal AntibodyZNF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14381-200ul 200ul
£332.50
A14381-100ul 100ul
£192.50
A14381-50ul 50ul
£113.75
A14381-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14381
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF2; A1-5; ZNF661; Zfp661; zinc finger protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 136-425 of human ZNF2 (NP_066574.2).
Reactivity Human, Mouse, Rat
Gene ID 7549
Calculated MW 44kDa/48kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECSVCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKAFFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFSSKSSVIQHQRRYAKQGID
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents