ZNF195 Polyclonal AntibodyZNF195 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF195 Polyclonal Antibody

Cat# Size Price Qty Buy
A14071-200ul 200ul
£332.50
A14071-100ul 100ul
£192.50
A14071-50ul 50ul
£113.75
A14071-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14071
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF195; HRF1; ZNFP104; zinc finger protein 195
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ZNF195 (NP_001123991.1).
Reactivity Human, Mouse
Gene ID 7748
Calculated MW 10kDa/64kDa/69kDa/70kDa/72kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents