ZNF157 Polyclonal AntibodyZNF157 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZNF157 Polyclonal Antibody

Cat# Size Price Qty Buy
A14323-200ul 200ul
£332.50
A14323-100ul 100ul
£192.50
A14323-50ul 50ul
£113.75
A14323-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14323
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZNF157; HZF22; zinc finger protein 157
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-165 of human ZNF157 (NP_003437.2).
Reactivity Human
Gene ID 7712
Calculated MW 58kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents