ZFP64 Polyclonal AntibodyZFP64 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZFP64 Polyclonal Antibody

Cat# Size Price Qty Buy
A15863-20ul 20ul
£77.00
A15863-50ul 50ul
£113.75
A15863-100ul 100ul
£192.50
A15863-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15863
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZFP64; ZNF338; zinc finger protein 64
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZFP64 (NP_060667.2).
Reactivity Human, Mouse
Gene ID 55734
Calculated MW 46kDa/48kDa/68kDa/72kDa/74kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAAAPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents