ZFP42 Polyclonal AntibodyZFP42 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZFP42 Polyclonal Antibody

Cat# Size Price Qty Buy
A15954-20ul 20ul
£77.00
A15954-50ul 50ul
£113.75
A15954-100ul 100ul
£192.50
A15954-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15954
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZFP42; REX-1; REX1; ZNF754; zfp-42; ZFP42 zinc finger protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZFP42 (NP_777560.2).
Reactivity Human
Gene ID 132625
Calculated MW 34kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents