ZDHHC15 Polyclonal AntibodyZDHHC15 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZDHHC15 Polyclonal Antibody

Cat# Size Price Qty Buy
A14454-200ul 200ul
£332.50
A14454-100ul 100ul
£192.50
A14454-50ul 50ul
£113.75
A14454-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14454
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZDHHC15; DHHC15; MRX91; palmitoyltransferase ZDHHC15
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 238-337 of human ZDHHC15 (NP_659406.1).
Reactivity Human, Rat
Gene ID 158866
Calculated MW 17kDa/38kDa/39kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents