ZC3H7A Polyclonal AntibodyZC3H7A Polyclonal Antibody
Move your mouse over image or click to enlarge

ZC3H7A Polyclonal Antibody

Cat# Size Price Qty Buy
A13190-200ul 200ul
£332.50
A13190-100ul 100ul
£192.50
A13190-50ul 50ul
£113.75
A13190-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13190
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZC3H7A; HSPC055; ZC3H7; ZC3HDC7; zinc finger CCCH-type containing 7A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ZC3H7A (NP_054872.2).
Reactivity Human
Gene ID 29066
Calculated MW 19kDa/110kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents