ZC3H10 Polyclonal AntibodyZC3H10 Polyclonal Antibody
Move your mouse over image or click to enlarge

ZC3H10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13753-200ul 200ul
£332.50
A13753-100ul 100ul
£192.50
A13753-50ul 50ul
£113.75
A13753-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13753
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ZC3H10; ZC3HDC10; zinc finger CCCH-type containing 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ZC3H10 (NP_116175.1).
Reactivity Human
Gene ID 84872
Calculated MW 46kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVITLSSTAPATEQTLAPTVG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents