ZAK Polyclonal AntibodyZAK Polyclonal Antibody
Move your mouse over image or click to enlarge

ZAK Polyclonal Antibody

Cat# Size Price Qty Buy
A14513-200ul 200ul
£332.50
A14513-100ul 100ul
£192.50
A14513-50ul 50ul
£113.75
A14513-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14513
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAP3K20; AZK; MLK7; MLT; MLTK; MLTKalpha; MLTKbeta; MRK; SFMMP; ZAK; mlklak; pk; mitogen-activated protein kinase kinase kinase 20
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-312 of human ZAK (NP_598407.1).
Reactivity Mouse, Rat
Gene ID 51776
Calculated MW 35kDa/51kDa/91kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents