YY1AP1 Polyclonal AntibodyYY1AP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

YY1AP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13104-200ul 200ul
£332.50
A13104-100ul 100ul
£192.50
A13104-50ul 50ul
£113.75
A13104-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13104
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names YY1AP1; GRNG; HCCA1; HCCA2; YY1AP; YY1-associated protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YY1AP1 (NP_060723.2).
Reactivity Human, Mouse, Rat
Gene ID 55249
Calculated MW 50kDa/75-97kDa
Observed MW 88kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents