YOD1 Polyclonal AntibodyYOD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

YOD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13270-200ul 200ul
£332.50
A13270-100ul 100ul
£192.50
A13270-50ul 50ul
£113.75
A13270-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13270
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names YOD1; DUBA8; OTUD2; PRO0907; YOD1 deubiquitinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human YOD1 (NP_061036.3).
Reactivity Human, Mouse
Gene ID 55432
Calculated MW 33kDa/38kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents