YKL-40 / CHI3L1 Polyclonal AntibodyYKL-40 / CHI3L1 Polyclonal Antibody
Move your mouse over image or click to enlarge

YKL-40 / CHI3L1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3166-200ul 200ul
£332.50
A3166-100ul 100ul
£192.50
A3166-50ul 50ul
£113.75
A3166-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3166
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHI3L1; ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; YKL-40; YKL40; YYL-40; hCGP-39; chitinase 3 like 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human YKL-40 / CHI3L1 (NP_001267.2).
Reactivity Human, Mouse, Rat
Gene ID 1116
Calculated MW 42kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents