XCL1 Polyclonal AntibodyXCL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

XCL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14490-200ul 200ul
£332.50
A14490-100ul 100ul
£192.50
A14490-50ul 50ul
£113.75
A14490-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14490
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names XCL1; ATAC; LPTN; LTN; SCM-1; SCM-1a; SCM1; SCM1A; SCYC1; lymphotactin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human XCL1 (NP_002986.1).
Reactivity Rat
Gene ID 6375
Calculated MW 12kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents