WNT7A Polyclonal AntibodyWNT7A Polyclonal Antibody
Move your mouse over image or click to enlarge

WNT7A Polyclonal Antibody

Cat# Size Price Qty Buy
A14194-200ul 200ul
£332.50
A14194-100ul 100ul
£192.50
A14194-50ul 50ul
£113.75
A14194-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14194
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names WNT7A; protein Wnt-7a
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-150 of human WNT7A (NP_004616.2).
Reactivity Mouse, Rat
Gene ID 7476
Calculated MW 39kDa
Observed MW 39kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents